Arginase 1/ARG1/liver Arginase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54621

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54621
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

IF/IHC, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all Arginase 1/ARG1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ARG1(arginase, liver) The peptide sequence was selected from the N terminal of ARG1 (NP_000036). Peptide sequence HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Human reactivity reported in scientific literature (Andreou KE et al).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Arginase 1/ARG1/liver Arginase Antibody

Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621]

Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621]

Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621] - Jurkat cell lysate, concentration 5.0ug/ml.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621]

Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Arginase 1/ARG1/liver Arginase Antibody

Immunohistochemistry: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621] -

Immunohistochemistry: Arginase 1/ARG1/liver Arginase Antibody [NBP1-54621] - Genetic deletion of IL-6 results in less fibrosis and increased remodeling at a chronic time point. A) Anti-Arginase 1/ARG1/liver Arginase immunohistochemistry staining results (n = 4-5; ∗P = .0210) and representative slides. The number of Arg1+ cells, a marker for prohealing monocytes and macrophages, was less in the IL-6-/- model. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35647566/) licensed under a CC-BY license.
View 1 more images

Applications for Arginase 1/ARG1/liver Arginase Antibody

Application
Recommended Usage

Immunohistochemistry

4-8 ug/ml

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Arginase 1/ARG1

Arginase 1 (ARG1), also known as liver arginase, is a metalloenzyme that is a member of the ureohydrolase superfamily and arginase family (1). ARG1 is known for its role in the urea cycle in catalyzing the conversion of L-arginine into urea and L-ornithine (1). Arginase has two distinct isoforms, with ARG1 being expressed primarily in the liver and ARG2 in extrahepatic tissues (1). Human ARG1 is synthesized as 322 amino acids (aa) in length with a theoretical molecular weight of 35 kDa (1,2). Three ARG1 monomers can form a highly active homotrimer of 105 kDa (1). A key structural feature of the arginase protein is the binuclear magnesium (Mn2+) ions at its core (1).

Arginase and nitric oxidase synthase (NOS) compete for the same L-arginine substrate, creating a delicate balance between pathways (1). Furthermore, bioavailability of L-arginine and ARG1 expression has been implicated in several pathologies including vascular disease, neuronal disease, cardiovascular disease, immune dysfunction, inflammation, and cancer (1,3-5). For instance, ARG1 functions as a macrophage marker, defining the M2 population, while inducible nitric oxide synthase (iNOS) characterizes the M1 population; impaired M1/M2 polarization and changes in ARG1 expression is observed in diseases such as arteriogenesis, asthma, pulmonary fibrosis, and inflammatory bowel disease (1,3). In humans, arginase deficiency, known as argininemia, is an autosomal recessive metabolic disorder characterized by elevated ammonia (hyperammonemia) levels and arginine accumulation (6). Given that many arginase-associated diseases are characterized by upregulation in expression of ARG1, ARG2, or both, arginase inhibitors are currently being studied as a potential therapeutic approach (1,4).

References

1. S Clemente, G., van Waarde, A., F Antunes, I., Domling, A., & H Elsinga, P. (2020). Arginase as a Potential Biomarker of Disease Progression: A Molecular Imaging Perspective. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms21155291

2. Uniprot (P05089)

3. Kieler, M., Hofmann, M., & Schabbauer, G. (2021). More than just protein building blocks: How amino acids and related metabolic pathways fuel macrophage polarization. The FEBS Journal. Advance online publication. https://doi.org/10.1111/febs.15715

4. Shosha, E., Fouda, A. Y., Narayanan, S. P., Caldwell, R. W., & Caldwell, R. B. (2020). Is the Arginase Pathway a Novel Therapeutic Avenue for Diabetic Retinopathy?. Journal of Clinical Medicine. https://doi.org/10.3390/jcm9020425

5. Correale J. (2021). Immunosuppressive Amino-Acid Catabolizing Enzymes in Multiple Sclerosis. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2020.600428

6. Morales, J. A., & Sticco, K. L. (2020). Arginase Deficiency. In StatPearls. StatPearls Publishing.

Long Name

Liver-Type Arginase

Alternate Names

AI, ARG1, Arginase-1, Liver Arginase, PGIF, Type I Arginase

Entrez Gene IDs

383 (Human)

Gene Symbol

ARG1

UniProt

P05089

Additional Arginase 1/ARG1 Products

Product Documents for Arginase 1/ARG1/liver Arginase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Arginase 1/ARG1/liver Arginase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.