Skip to main content

ARID1A Antibody (9D4J6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-33201

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-33201-100ul
NBP3-33201-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9D4J6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1204-1314 of human ARID1A (O14497).

Sequence:
SMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

242 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARID1A Antibody (9D4J6)

ARID1A Antibody (9D4J6)

Immunohistochemistry: ARID1A Antibody (9D4J6) [NBP3-33201] -

Immunohistochemistry: ARID1A Antibody (9D4J6) [NBP3-33201] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using ARID1A Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
ARID1A Antibody (9D4J6)

Western Blot: ARID1A Antibody (9D4J6) [NBP3-33201] -

Western Blot: ARID1A Antibody (9D4J6) [NBP3-33201] - Western blot analysis of lysates from PC-3 cells, using ARID1A Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
ARID1A Antibody (9D4J6)

Immunohistochemistry: ARID1A Antibody (9D4J6) [NBP3-33201] -

Immunohistochemistry: ARID1A Antibody (9D4J6) [NBP3-33201] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using ARID1A Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for ARID1A Antibody (9D4J6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARID1A

ARID1A encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain ARID1A genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1

Gene Symbol

ARID1A

Additional ARID1A Products

Product Documents for ARID1A Antibody (9D4J6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ARID1A Antibody (9D4J6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...