ATP6V0A1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59949

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59949
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

In vivo assay, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ATP6V0A1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP6V0A1(ATPase, H+ transporting, lysosomal V0 subunit a1) The peptide sequence was selected from the N terminal of ATP6V0A1. Peptide sequence RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: a isoform 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP6V0A1 Antibody

Western Blot: ATP6V0A1 Antibody [NBP1-59949]

Western Blot: ATP6V0A1 Antibody [NBP1-59949]

Western Blot: ATP6V0A1 Antibody [NBP1-59949] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for ATP6V0A1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0A1

ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1

Gene Symbol

ATP6V0A1

UniProt

Q93050 (Human)

Additional ATP6V0A1 Products

Product Documents for ATP6V0A1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATP6V0A1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.