Skip to main content

ATP6V0A1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87054

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-87054

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse ATP6V0A1. Peptide sequence: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ATP6V0A1 Antibody - BSA Free

Western Blot: ATP6V0A1 Antibody [NBP2-87054]

Western Blot: ATP6V0A1 Antibody [NBP2-87054]

Western Blot: ATP6V0A1 Antibody [NBP2-87054] - WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Uterus

Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP2-87054] -

Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP2-87054] - Sample Type: A. untransfected HeLa cells B. mATP6V0A1 transfected HeLa cells. Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: Atp6v0a1: Green DAPI:Blue. Gene Name: Atp6v0a1 . Submitted by: Anonymous
Western Blot: ATP6V0A1 Antibody [NBP2-87054]

Western Blot: ATP6V0A1 Antibody [NBP2-87054]

Western Blot: ATP6V0A1 Antibody [NBP2-87054] - Host: Rabbit. Target Name: Atp6v0a1. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for ATP6V0A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0A1

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1

Gene Symbol

ATP6V0A1

Additional ATP6V0A1 Products

Product Documents for ATP6V0A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V0A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...