Skip to main content

ATP6V1E1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38049

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 77-226 of human ATP6V1E1 (NP_001687.1).

Sequence:
NQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP6V1E1 Antibody - BSA Free

ATP6V1E1 Antibody

Western Blot: ATP6V1E1 Antibody [NBP3-38049] -

Western Blot: ATP6V1E1 Antibody [NBP3-38049] - Western blot analysis of various lysates using ATP6V1E1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
ATP6V1E1 Antibody

Western Blot: ATP6V1E1 Antibody [NBP3-38049] -

Western Blot: ATP6V1E1 Antibody [NBP3-38049] - Western blot analysis of various lysates using ATP6V1E1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
ATP6V1E1 Antibody

Immunocytochemistry/ Immunofluorescence: ATP6V1E1 Antibody [NBP3-38049] -

Immunocytochemistry/ Immunofluorescence: ATP6V1E1 Antibody [NBP3-38049] - Immunofluorescence analysis of HeLa cells using ATP6V1E1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ATP6V1E1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP6V1E1

ATP6V1E1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq]

Alternate Names

ATP6E2ATP6V1E, ATP6E31kDa subunit, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1, H+-transporting ATP synthase chain E, vacuolar, p31, Vacuolar proton pump subunit E 1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, V-ATPase, subunit E, Vma4, V-type proton ATPase subunit E 1

Gene Symbol

ATP6V1E1

Additional ATP6V1E1 Products

Product Documents for ATP6V1E1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V1E1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...