ATPase Na+/K+ beta 3 Antibody (0B7M7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15829

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15829-100ul
NBP3-15829-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0B7M7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all ATPase Na+/K+ beta 3 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 180-279 of human ATPase Na+/K+ beta 3 (P54709). GLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATPase Na+/K+ beta 3 Antibody (0B7M7)

Western Blot: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829]

Western Blot: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829]

Western Blot: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829] - Analysis of extracts of various cell lines, using ATPase Na+/K+ beta 3 Rabbit mAb (NBP3-15829) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody (0B7M7) [NBP3-15829] - Human liver cancer using ATPase Na+/K+ beta 3 Rabbit mAb (NBP3-15829) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for ATPase Na+/K+ beta 3 Antibody (0B7M7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATPase Na+/K+ beta 3

ATPase Na+/ K+ beta 3 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq]

Long Name

Sodium/potassium-transporting ATPase subunit beta-3

Alternate Names

ATP1B3, ATPB-3, CD antigen CD298

Gene Symbol

ATP1B3

Additional ATPase Na+/K+ beta 3 Products

Product Documents for ATPase Na+/K+ beta 3 Antibody (0B7M7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATPase Na+/K+ beta 3 Antibody (0B7M7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.