ATPase Na+/K+ beta 3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38595

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38595
NBP2-38595-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ATPase Na+/K+ beta 3 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATPase Na+/K+ beta 3 Antibody

Immunocytochemistry/ Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunocytochemistry/ Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunocytochemistry/Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Applications for ATPase Na+/K+ beta 3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPase Na+/K+ beta 3

ATPase Na+/ K+ beta 3 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq]

Long Name

Sodium/potassium-transporting ATPase subunit beta-3

Alternate Names

ATP1B3, ATPB-3, CD antigen CD298

Gene Symbol

ATP1B3

UniProt

P54709 (Human)

Additional ATPase Na+/K+ beta 3 Products

Product Documents for ATPase Na+/K+ beta 3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATPase Na+/K+ beta 3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.