ATPB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54700

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54700
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all ATPB Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the N terminal of ATP5B. Peptide sequence PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta, mitochondrial.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATPB Antibody

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.
View 1 more images

Applications for ATPB Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPB

ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ATP synthase subunit beta, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB, ATPSBmitochondrial ATP synthase beta subunit, EC 3.6.3, EC 3.6.3.14, MGC5231, mitochondrial ATP synthetase, beta subunit

Entrez Gene IDs

506 (Human)

Gene Symbol

ATP5F1B

UniProt

P06576 (Human)

Additional ATPB Products

Product Documents for ATPB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATPB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.