Brorin/VWC2 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05639

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-05639-100ul
NBP3-05639-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Brorin/VWC2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 28-134 of human Brorin/VWC2 (NP_796007.1). SPSIPLEKLAQAPEQPGQEKREHASRDSPGRVSELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSAKAADWQVRPRGDTPQGEPPAAAQEAISLEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Brorin/VWC2 Antibody - Azide and BSA Free

Western Blot: Brorin/VWC2 AntibodyAzide and BSA Free [NBP3-05639]

Western Blot: Brorin/VWC2 AntibodyAzide and BSA Free [NBP3-05639]

Western Blot: Brorin/VWC2 Antibody [NBP3-05639] - Western blot analysis of extracts of various cell lines, using Brorin/VWC2 antibody (NBP3-05639) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Brorin/VWC2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Brorin/VWC2

Brorin (brain-specific chordin-like protein), also called VWC2, is an ~46 kDa glycoprotein that is a member of the Chordin family of secreted BMP regulators. The human Brorin cDNA encodes 325 amino acids (aa) including a 27 aa signal sequence and a 298 aa secreted mature protein with two VWFC domains. These domains contain a pattern of 10 cysteine residues that is conserved in other family members, with the remaining aa sequence sharing little identity. Human Brorin shares 90%, 91%, and 95% aa sequence identity with mouse, rat, and equine Brorin, respectively. It also shares aa identity with VWC2L (Brorin-like) of 37% overall and 62% within the VWFC domains. Brorin is predominantly expressed in embryonic and adult neural tissues in the mouse. Expression of Brorin mRNA is concentrated in neurons within the diencephalon and medulla oblongata but is not detected in the developing cerebral cortex. Brorin binds and antagonizes BMPs, interacting via the VWFC domains. It promotes neurogenesis in mouse neural precursors. Knockdown of Brorin in zebrafish embryos results in morphological abnormalities in the brain and eye.

Long Name

von Willebrand Factor A2 Domain

Alternate Names

Brain-specific chordin-like protein, VWC2

Gene Symbol

VWC2

Additional Brorin/VWC2 Products

Product Documents for Brorin/VWC2 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Brorin/VWC2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.