C-Reactive Protein/CRP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87183

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87183
NBP1-87183-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all C-Reactive Protein/CRP Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for C-Reactive Protein/CRP Antibody

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183]

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183]

Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87183] - Analysis using Anti-CRP antibody NBP1-87183 (A) shows similar pattern to independent antibody NBP1-87184 (B).
Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183]

Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183]

Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87183] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Applications for C-Reactive Protein/CRP Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: C-Reactive Protein/CRP

C Reactive Protein is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is a pentraxin (cyclic pentameric protein) compound of five identical nonglycosylated subunits of 206 amino acids each (m.w. 24 kDa), that are bound noncovalently to form the physiologic CRP molecule (m.w. 117.5 kDa). C Reactive Protein mediates activities associated with preimmune nonspecific host resistance. It is opsonic, an initiator of the classical complement cascade and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. Studies have revealed that among other markers of inflammation, CRP shows the strongest association with cardiovascular events. Many clinical studies demonstrated that coronary mortality among patients with unstable angina and elevated CRP is significantly higher comparing with the patients without elevated CRP. Measurements of C reactive protein (hsCRP) in the patients with ischemic heart disease provide a novel method for detecting individuals at high risk of plaque rupture.

Alternate Names

CRP

Gene Symbol

CRP

Additional C-Reactive Protein/CRP Products

Product Documents for C-Reactive Protein/CRP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for C-Reactive Protein/CRP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.