CARD14 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86596

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86596-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all CARD14 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CARD14. Peptide sequence: QQCTVTRKPSSGGPQKLVRIVSMDKAKASPLRLSFDRGQLDPSRMEGSST The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CARD14 Antibody

Western Blot: CARD14 Antibody [NBP2-86596]

Western Blot: CARD14 Antibody [NBP2-86596]

Western Blot: CARD14 Antibody [NBP2-86596] - Host: Rabbit. Target Name: CARD14. Sample Tissue: Human Neurofibroma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for CARD14 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CARD14

The protein encoded by the CARD14 gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class ofproteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions ofthe plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying acharacteristic caspase-associated recruitment domain (CARD). This protein shares a similar domain structure withCARD11 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein knownto function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this proteinactivated NF-kappaB and induced the phosphorylation of BCL10. Two alternatively spliced variants of this gene encodingdistinct isoforms have been reported. (provided by RefSeq)

Alternate Names

bcl10-interacting maguk protein 2, BIMP2, CARD-containing MAGUK protein 2, card-maguk protein 2, Carma 2, CARMA2CARD-containing MAGUK 2 protein, caspase recruitment domain family, member 14, caspase recruitment domain-containing protein 14

Gene Symbol

CARD14

Additional CARD14 Products

Product Documents for CARD14 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CARD14 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.