CDK8 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92972

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-92972-0.02ml
NBP2-92972-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunoprecipitation, Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CDK8 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CDK8 Antibody - BSA Free

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of 200ug extracts of Jurkat cells, using CDK8 antibody . Western blot was performed from the immunoprecipitate using this antibody
Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 AntibodyBSA Free [NBP2-92972]

Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts of Jurkat cells, using CDK8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .
Knockout Validated: CDK8 Antibody - BSA Free [NBP2-92972]

Knockout Validated: CDK8 Antibody - BSA Free [NBP2-92972]

Knockout Validated: CDK8 Antibody [NBP2-92972] - Analysis of extracts from normal (control) and CDK8 knockout (KO) HeLa cells, using CDK8 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Applications for CDK8 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:50 - 1:100

Western Blot

1:500 - 1:2000

Reviewed Applications

Read 1 review rated 5 using NBP2-92972 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH 7.3

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDK8

Cdk8 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.

Long Name

Cyclin-dependent Kinase 8

Alternate Names

Protein kinase K35

Gene Symbol

CDK8

Additional CDK8 Products

Product Documents for CDK8 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CDK8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.