CKII alpha prime polypeptide Antibody (3W5P4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16076

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16076-100ul
NBP3-16076-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3W5P4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CKII alpha prime polypeptide Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1). LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CKII alpha prime polypeptide Antibody (3W5P4)

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076]

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076]

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076] - Western blot analysis of extracts of various cell lines, using CKII alpha prime polypeptide antibody (NBP3-16076) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076]

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076]

Western Blot: CKII alpha prime polypeptide Antibody (3W5P4) [NBP3-16076] - Western blot analysis of extracts of various cell lines, using CKII alpha prime polypeptide antibody (NBP3-16076) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for CKII alpha prime polypeptide Antibody (3W5P4)

Application
Recommended Usage

Immunoprecipitation

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CKII alpha prime polypeptide

CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.

Long Name

Casein kinase II subunit alpha'

Alternate Names

CK II alpha', CK2A2, CSNK2A2

Gene Symbol

CSNK2A2

Additional CKII alpha prime polypeptide Products

Product Documents for CKII alpha prime polypeptide Antibody (3W5P4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CKII alpha prime polypeptide Antibody (3W5P4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.