Clathrin light chain Antibody (4E9)

Novus Biologicals, part of Bio-Techne | Catalog # H00001211-M08

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00001211-M08
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4E9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Clathrin light chain Antibodies »

Product Specifications

Immunogen

CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Clathrin light chain Antibody (4E9)

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08]

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08]

Western Blot: Clathrin light chain Antibody (4E9) [H00001211-M08] - Analysis of CLTA expression in human kidney.
Sandwich ELISA: Clathrin light chain Antibody (4E9) [H00001211-M08] - Detection limit for recombinant GST tagged CLTA is 0.03 ng/ml as a capture antibody.

Applications for Clathrin light chain Antibody (4E9)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
It has been used for ELISA and WB.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Clathrin light chain

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Transcript Variant: This variant (1) lacks alternate in-frame exons, compared to variant 2, resulting in a shorter protein (isoform a), compared to isoform b. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

clathrin light chain A, clathrin, light chain A, Lca, light polypeptide (Lca)

Gene Symbol

CLTA

UniProt

NP_001824 (Human)

Additional Clathrin light chain Products

Product Documents for Clathrin light chain Antibody (4E9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Clathrin light chain Antibody (4E9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.