Claudin-6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10557

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10557-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Claudin-6 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_061247). Peptide sequence GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Claudin-6 Antibody

Western Blot: Claudin-6 Antibody [NBP3-10557]

Western Blot: Claudin-6 Antibody [NBP3-10557]

Western Blot: Claudin-6 Antibody [NBP3-10557] - Western blot analysis using NBP3-10557 on Mouse Heart as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Claudin-6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-6

The claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the claudins, Occludin and junction adhesion molecule. Claudins, which consist of four transmembrane domains and two extracellular loops make up tight junction strands. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions. Claudin-6 is expressed in differentiated F9 cells that resemble tight junction-bearing viceral endoderm resulting from stimulation with retinoc acid and mediated by RXRalpha and RARgamma. Claudin-6 is absent in mouse brain and lung. The human claudin-6 gene maps to chromosome 16p13.3.

Alternate Names

Claudin6, CLDN6, Skullin 2

Gene Symbol

CLDN6

Additional Claudin-6 Products

Product Documents for Claudin-6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Claudin-6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.