CLCN4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57670

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57670
NBP2-57670-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all CLCN4 Antibodies »

Product Summary for CLCN4 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLCN4 Antibody

Immunocytochemistry/ Immunofluorescence: CLCN4 Antibody [NBP2-57670]

Immunocytochemistry/ Immunofluorescence: CLCN4 Antibody [NBP2-57670]

Immunocytochemistry/Immunofluorescence: CLCN4 Antibody [NBP2-57670] - Staining of human cell line PC-3 shows localization to vesicles. Antibody staining is shown in green.

Applications for CLCN4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCN4

The family of voltage-dependent chloride channels (CLCs) regulate cellular trafficking of chloride ions, a critical component of all living cells. CLCs regulate excitability in muscle and nerve cells, aid in organic solute transport and maintain cellular volume. The genes encoding human CLC-1 through CLC-7 map to chromosomes 7, 3q26, 4q32, Xp22, Xp11, 1p36 and 16p13, respectively. CLC-1 is highly expressed in skeletal muscle. Mutations in the gene encoding CLC-1 lead to myotonia, an inheritable disorder characterized by muscle stiffness and renal salt wasting. CLC-2 is highly expressed in the epithelia of several organs including lung, which suggests CLC-2 may be a possible therapeutic target for cystic fibrosis. CLC-3 expression is particularly abundant in neuronal tissue, while CLC-4 expression is evident in skeletal and cardiac muscle as well as brain. Mutations in the gene encoding CLC-5 lead to Dent's disease, a renal disorder characterized by proteinuria and hypercalciuria. CLC-6 and CLC-7 are broadly expressed in several tissues including testes, kidney, brain and muscle.

Alternate Names

chloride channel 4, Chloride channel protein 4, Chloride transporter ClC-4, CLC4, ClC-4, ClC-4A, H(+)/Cl(-) exchange transporter 4, MGC163150

Gene Symbol

CLCN4

Additional CLCN4 Products

Product Documents for CLCN4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CLCN4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.