CLCN5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69123

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69123
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all CLCN5 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CLCN5 Antibody

Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Brain Antibody Dilution: 1.0 ug/ml
Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123] - Mouse Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123]

Western Blot: CLCN5 Antibody [NBP1-69123] - Rat Liver. Antibody Dilution: 1.0 ug/ml.
View 5 more images

Applications for CLCN5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCN5

Clcn5 is a proton-coupled chloride transporter. Clcn5 functions as antiport system and exchanges chloride ions against protons. Clcn5 is important for normal acidification of the endosome lumen.Clcn5 may play an important role in renal tubular function.

Alternate Names

chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, CLC5, clC-5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN

Gene Symbol

CLCN5

Additional CLCN5 Products

Product Documents for CLCN5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CLCN5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.