Coatomer Subunit Delta Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35490

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-35490-100ul
NBP3-35490-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Coatomer Subunit Delta Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 212-511 of human Coatomer Subunit Delta (NP_001646.2).

Sequence:
VAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Coatomer Subunit Delta Antibody

Coatomer Subunit Delta Antibody

Western Blot: Coatomer Subunit Delta Antibody [NBP3-35490] -

Western Blot: Coatomer Subunit Delta Antibody [NBP3-35490] - Western blot analysis of various lysates using Coatomer Subunit Delta Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Coatomer Subunit Delta Antibody

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] -

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] - Immunofluorescence analysis of HeLa cells using Coatomer Subunit Delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Coatomer Subunit Delta Antibody

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] -

Immunocytochemistry/ Immunofluorescence: Coatomer Subunit Delta Antibody [NBP3-35490] - Immunofluorescence analysis of C6 cells using Coatomer Subunit Delta Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
View 1 more images

Applications for Coatomer Subunit Delta Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Coatomer Subunit Delta

Coatomer Subunit Delta maps in a region, which include the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. It is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking. [provided by RefSeq]

Alternate Names

Archain, archain 1, archain vesicle transport protein 1, coatomer delta subunit, coatomer protein complex, subunit delta, coatomer protein delta-COP, coatomer subunit delta, COPD, Delta-coat protein, delta-COP

Gene Symbol

ARCN1

Additional Coatomer Subunit Delta Products

Product Documents for Coatomer Subunit Delta Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Coatomer Subunit Delta Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.