COPZ1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10765

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10765-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all COPZ1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COPZ1 (NP_001258663.1). Peptide sequence YTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for COPZ1 Antibody

Western Blot: COPZ1 Antibody [NBP3-10765]

Western Blot: COPZ1 Antibody [NBP3-10765]

Western Blot: COPZ1 Antibody [NBP3-10765] - Western blot analysis of COPZ1 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for COPZ1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COPZ1

Membrane and vesicular trafficking in the early secretory pathway are mediated by non-Clathrin COP (coat protein) I-coated vesicles. COPI-coated vesicles mediate retrograde transport from the Golgi back to the ER and intra-Golgi transport. The cytosolic precursor of the COPI coat, the heptameric coatomer complex, is composed of two subcomplexes. The first consists of the COPB, COPG, COPD and COPZ1 subunits (also known as beta-COP, gamma-COP, delta-COP and zeta-1 COP, respectively), which are distantly homologous to AP Clathrin adaptor subunits. The second consists of the COPA, COPP and COPE subunits (also known as alpha-COP, COPP and episilon-COP, respectively).

Alternate Names

CGI-120, coatomer protein complex, subunit zeta, coatomer protein complex, subunit zeta 1, coatomer subunit zeta-1, COPZ, Zeta-1 COP, Zeta-1-coat protein, zeta1-COP

Gene Symbol

COPZ1

Additional COPZ1 Products

Product Documents for COPZ1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for COPZ1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.