COX10 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59554

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59554
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all COX10 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to COX10(COX10 homolog, cytochrome c oxidase assembly protein, heme A) The peptide sequence was selected from the middle region of COX10. Peptide sequence APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COX10 Antibody

Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.
Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554] - This Anti-COX10 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.
Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554]

Western Blot: COX10 Antibody [NBP1-59554] - Middle region validated by WB using mouse mitochondria at 1:1000.

Applications for COX10 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COX10

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is heme A: farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase), COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast), cytochrome c oxidase assembly protein, cytochrome c oxidase subunit X, EC 2.5.1.-, heme A: farnesyltransferase, Heme O synthase, protoheme IX farnesyltransferase, mitochondrial

Gene Symbol

COX10

UniProt

Q12887 (Human)

Additional COX10 Products

Product Documents for COX10 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for COX10 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.