Cytokeratin 17 Antibody (9O6X9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16271

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16271-100ul
NBP3-16271-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O6X9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Cytokeratin 17 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (Q04695). MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 17 Antibody (9O6X9)

Western Blot: Cytokeratin 17 Antibody (9O6X9) [NBP3-16271]

Western Blot: Cytokeratin 17 Antibody (9O6X9) [NBP3-16271]

Western Blot: Cytokeratin 17 Antibody (9O6X9) [NBP3-16271] - Western blot analysis of extracts of HeLa cells, using Cytokeratin 17 (KRT17) Rabbit mAb (NBP3-16271) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Cytokeratin 17 Antibody (9O6X9)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 17

Among the members of the cytokeratin (CK) subfamily of intermediate filament (IF) proteins, CK 17 is normally expressed in the basal cells of complex epithelia but not in stratified or simple epithelia. It has an unusual expression pattern in normal and diseased states and has potential importance in tumor diagnosis. CK 17 synthesis seems to be a marker of basal cell differentiation in complex epithelia and therefore indicative of a certain type of epithelial "stem cells" (1). It has been shown that CK 17 regulates cell growth through binding to the adaptor protein 14-3-3sigma. These findings reveal a new and unexpected role for the intermediate filament cytoskeleton in influencing cell growth and size by regulating protein synthesis (2). CK 17 is expressed in the nail bed, hair follicle, sebaceous glands, and other epidermal appendages (3).

Long Name

Cytokeratin 17/KRT17

Alternate Names

CK-17, cytokeratin-17, K17, keratin 17, type I, keratin, type I cytoskeletal 17, PCHC1

Gene Symbol

KRT17

Additional Cytokeratin 17 Products

Product Documents for Cytokeratin 17 Antibody (9O6X9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytokeratin 17 Antibody (9O6X9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.