Cytokeratin 20 Antibody (CL9390)

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88932

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88932
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # CL9390

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Cytokeratin 20 Antibodies »

Product Summary for Cytokeratin 20 Antibody (CL9390)

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for Cytokeratin 20 Antibody (CL9390)

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (CL9390) [NBP2-88932] - Staining of human prostate shows no positivity in glandular cells as expected.
View 2 more images

Applications for Cytokeratin 20 Antibody (CL9390)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, pH 7.2, containing 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 20

Intermediate-sized filament (IF) protein designated cytokeratin (CK) 1 is a major cellular protein of mature enterocytes and goblet cells commonly found in mucosal epithelium of the mammalian gastrointestinal tract (1). Results strongly suggest that transcriptional regulation of keratin genes in the intestinal epithelium occurs at the level of both immature and terminally differentiated epithelial cells, and is tightly regulated during both fetal development and crypt-to-villus differentiation of the intestinal epithelium (2). CK20 has recently been reported to be useful to distinguish between primary and metastatic lung adenocarcinoma. CK20 expression was significantly more prevalent in adenocarcinoma that originated in the GI tract than that of pulmonary or breast origin (3).

Alternate Names

CD20, CK20, CK-20, Cytokeratin-20, K20cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT

Gene Symbol

KRT20

Additional Cytokeratin 20 Products

Product Documents for Cytokeratin 20 Antibody (CL9390)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytokeratin 20 Antibody (CL9390)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.