Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16595

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16595-100ul
NBP3-16595-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3J2O9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Dihydrolipoamide Dehydrogenase/DLD Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human Dihydrolipoamide Dehydrogenase/DLD (P09622). WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Western blot analysis of extracts of various cell lines, using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunofluorescence analysis of U-2 OS cells using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595]

Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry of paraffin-embedded mouse kidney using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dihydrolipoamide Dehydrogenase/DLD

Lipoamide Dehydrogenase encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Alternate Names

Diaphorase, DLD, DLDD, DLDH, GCSL, LAD, Lipoamide Dehydrogenase, PHE3

Gene Symbol

DLD

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Product Documents for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.