DRP2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84822

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84822-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all DRP2 Antibodies »

Product Summary for DRP2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of DRP2. Peptide sequence: LEEPHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DRP2 Antibody

Western Blot: DRP2 Antibody [NBP2-84822]

Western Blot: DRP2 Antibody [NBP2-84822]

Western Blot: DRP2 Antibody [NBP2-84822] - WB Suggested Anti-DRP2 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole Cell

Applications for DRP2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DRP2

Dystrophin, utrophin and dystrophin-related protein 2 (DRP2) are Actin-binding proteins that are involved in anchoring the cytoskeleton to the plasma membrane. Dystrophin is the protein product of the Duchenne/Becker muscular dystrophy gene. Dystrophin is expressed in muscle and brain tissues, where it is localized to the inner surface of the plasma membrane. Evidence suggests that the upregulation of utrophin (also known as DRP1) can reduce the dystrophic pathology. DRP2 is principally expressed in the brain and spinal cord. Analysis of DRP2 expression in rat brain on SDS-PAGE reveals a characteristic quartet of bands from 100-120 kDa. DRP2 exhibits a punctate staining pattern of rat neuronal dendrites and in neuropil. DRP2 forms a complex with dystroglycan at the surface of myelin-forming Schwann cells and may play a role in the terminal stages of myelinogenesis in the peripheral nervous system. The gene encoding human DRP2 maps to chromosome Xq22.

Alternate Names

dystrophin related protein 2, dystrophin-related protein 2, MGC133255

Gene Symbol

DRP2

Additional DRP2 Products

Product Documents for DRP2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DRP2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.