Dysbindin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85299

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85299
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Dysbindin Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dysbindin Antibody

Western Blot: Dysbindin Antibody [NBP1-85299]

Western Blot: Dysbindin Antibody [NBP1-85299]

Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Dysbindin Antibody [NBP1-85299]

Immunocytochemistry/ Immunofluorescence: Dysbindin Antibody [NBP1-85299]

Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human liver shows negative positivity in hepatocytes as expected.
View 3 more images

Applications for Dysbindin Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dysbindin

Dysbindin encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

DKFZp564K192, Dysbindin, Dysbindin-1, dystrobrevin binding protein 1, Dystrobrevin-binding protein 1, FLJ30031, Hermansky-Pudlak syndrome 7 protein, HPS7 protein, HPS7DBND, MGC20210, My031, SDY

Gene Symbol

DTNBP1

Additional Dysbindin Products

Product Documents for Dysbindin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Dysbindin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.