eEF1A1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-52880

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-52880
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all eEF1A1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eEF1A1 Antibody

Western Blot: eEF1A1 Antibody [NBP1-52880]

Western Blot: eEF1A1 Antibody [NBP1-52880]

Western Blot: eEF1A1 Antibody [NBP1-52880] - Antibody Titration: 1 ug/ml Human Hela.
Western Blot: eEF1A1 Antibody [NBP1-52880]

Western Blot: eEF1A1 Antibody [NBP1-52880]

Western Blot: eEF1A1 Antibody [NBP1-52880] - HepG2 cell lysate, concentration 2.5 ug/ml.

Applications for eEF1A1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eEF1A1

EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

CCS3, CCS-3, cervical cancer suppressor 3, CTCL tumor antigen, EE1A1, EEF-1, EEF1A, eEF1A-1, EF1AHNGC:16303, EF1a-like protein, EF-1-alpha-1, EF-Tu, elongation factor 1 alpha subunit, elongation factor 1-alpha 1, Elongation factor Tu, Eukaryotic elongation factor 1 A-1, eukaryotic translation elongation factor 1 alpha 1, eukaryotic translation elongation factor 1 alpha 1-like 14, FLJ25721, glucocorticoid receptor AF-1 specific elongation factor, GRAF-1EF, LENG7, leukocyte receptor cluster (LRC) member 7, Leukocyte receptor cluster member 7, MGC102687, MGC131894, MGC16224, prostate tumor-inducing protein 1, PTI1, translation elongation factor 1 alpha 1-like 14

Entrez Gene IDs

1915 (Human); 13627 (Mouse); 171361 (Rat)

Gene Symbol

EEF1A1

UniProt

P68104 (Human)

Additional eEF1A1 Products

Product Documents for eEF1A1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for eEF1A1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.