EEF1A2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55245

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55245
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all EEF1A2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EEF1A2(eukaryotic translation elongation factor 1 alpha 2) The peptide sequence was selected from the middle region of EEF1A2. Peptide sequence VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EEF1A2 Antibody

Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain
Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245] - Antibody Titration: 1 ug/ml Human HepG2.
Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245]

Western Blot: EEF1A2 Antibody [NBP1-55245] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
View 1 more images

Applications for EEF1A2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EEF1A2

EEF1A2 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, statin-S1, STN, STNL

Gene Symbol

EEF1A2

UniProt

Q05639 (Human)

Additional EEF1A2 Products

Product Documents for EEF1A2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for EEF1A2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.