EMR4P Antibody (1G10)

Novus Biologicals, part of Bio-Techne | Catalog # H00326342-M02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00326342-M02
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1G10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all EMR4 Antibodies »

Product Specifications

Immunogen

EMR4P (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG

Reactivity Notes

This product is reactive against Human.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for EMR4P Antibody (1G10)

Western Blot: EMR4P Antibody (1G10) [H00326342-M02]

Western Blot: EMR4P Antibody (1G10) [H00326342-M02]

Western Blot: EMR4P Antibody (1G10) [H00326342-M02] - EMR4P monoclonal antibody (M02), clone 1G10. Analysis of EMR4P expression in HeLa.
Immunocytochemistry/ Immunofluorescence: EMR4P Antibody (1G10) [H00326342-M02]

Immunocytochemistry/ Immunofluorescence: EMR4P Antibody (1G10) [H00326342-M02]

Immunocytochemistry/Immunofluorescence: EMR4P Antibody (1G10) [H00326342-M02] - Analysis of monoclonal antibody to EMR4P on HeLa cell . Antibody concentration 10 ug/ml.

Applications for EMR4P Antibody (1G10)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: EMR4

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene.

Long Name

EGF-like Module Containing, Mucin-like, Hormone Receptor-like 4

Alternate Names

Egf-tm7, Fire, Gpr127, PGR16

Gene Symbol

ADGRE4P

Additional EMR4 Products

Product Documents for EMR4P Antibody (1G10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for EMR4P Antibody (1G10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.