FAT10 Antibody (10A6T5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16731

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16731-100ul
NBP3-16731-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10A6T5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all FAT10 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FAT10 Antibody (10A6T5)

Western Blot: FAT10 Antibody (10A6T5) [NBP3-16731]

Western Blot: FAT10 Antibody (10A6T5) [NBP3-16731]

Western Blot: FAT10 Antibody (10A6T5) [NBP3-16731] - Analysis of extracts of various cell lines, using FAT10 Rabbit mAb (NBP3-16731) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731]

Immunocytochemistry/ Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731]

Immunocytochemistry/Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731] - Immunofluorescence analysis of U-2 OS cells using FAT10 Rabbit mAb (NBP3-16731) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731]

Immunocytochemistry/ Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731]

Immunocytochemistry/Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731] - Immunofluorescence analysis of C6 cells using FAT10 Rabbit mAb (NBP3-16731) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
View 1 more images

Applications for FAT10 Antibody (10A6T5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FAT10

Human Leukocyte Antigen-F Associated Transcript 10 (FAT10), also known as Ubiquitin D (UBD), is a 165 amino acid (aa) member of the Ubiquitin-like family of proteins. Human FAT10 has a predicted molecular weight of 18.5 kDa and shares 69% aa sequence identity with mouse FAT10. Human FAT10 mRNA is expressed as a single transcript in lymphoblastoid lines and dendritic cells, but more than one mRNA transcript has been identified for murine FAT10. FAT10 can also be induced by IFN-gamma and TNF-alpha in some cell lines. Structurally, FAT10 consists of two Ubiquitin-like domains that are connected by a short linker. Like Ubiquitin, FAT10 has a C-terminal glycine residue that can be used to form isopeptide bonds with target proteins. FAT10-conjugated proteins are targeted to the proteasome where the 26S Proteasome subunit S5a/Angiocidin binds to FAT10 and enables subsequent degradation of the conjugated protein. In addition to S5a/Angiocidin, FAT10 has been shown to interact with Huntingtin, Ataxin-1, MAD2, and NUB1L. FAT10 has been implicated in a number of biological processes such as cell cycle control, antigen presentation, and cytokine response.

Alternate Names

UBD

Gene Symbol

UBD

Additional FAT10 Products

Product Documents for FAT10 Antibody (10A6T5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FAT10 Antibody (10A6T5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.