FBXO11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55066

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55066
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Chromatin Immunoprecipitation (ChIP), Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all FBXO11 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409). Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FBXO11 Antibody

Western Blot: FBXO11 Antibody [NBP1-55066]

Western Blot: FBXO11 Antibody [NBP1-55066]

Western Blot: FBXO11 Antibody [NBP1-55066] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Chromatin Immunoprecipitation: FBXO11 Antibody [NBP1-55066] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: FBXO11 Antibody [NBP1-55066]

Western Blot: FBXO11 Antibody [NBP1-55066]

Western Blot: FBXO11 Antibody [NBP1-55066] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate FBXO11 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Applications for FBXO11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXO11

FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for FBXO11.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

F-box only protein 11, F-box protein 11, FBX11MGC44383, FLJ12673, PRMT9VIT1protein arginine N-methyltransferase 9, ubiquitin protein ligase E3 component n-recognin 6, UBR6, VIT-1, Vitiligo-associated protein 1, vitiligo-associated protein VIT-1

Entrez Gene IDs

80204 (Human); 301674 (Rat)

Gene Symbol

FBXO11

UniProt

Q86XK2 (Human)

Additional FBXO11 Products

Product Documents for FBXO11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FBXO11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.