Fibrillarin Antibody (9J5O2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15312

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15312-100ul
NBP3-15312-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9J5O2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Fibrillarin Antibodies »

Product Summary for Fibrillarin Antibody (9J5O2)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin (P22087). KYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fibrillarin Antibody (9J5O2)

Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312] - Western blot analysis of extracts of various cell lines, using Fibrillarin Rabbit mAb (NBP3-15312) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Immunocytochemistry/ Immunofluorescence: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Immunocytochemistry/Immunofluorescence: Fibrillarin Antibody (9J5O2) [NBP3-15312] - Immunofluorescence analysis of U-2 OS cells using Fibrillarin Rabbit mAb (NBP3-15312) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312]

Western Blot: Fibrillarin Antibody (9J5O2) [NBP3-15312] - Western blot analysis of extracts of various cell lines, using Fibrillarin Rabbit mAb (NBP3-15312) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
View 2 more images

Applications for Fibrillarin Antibody (9J5O2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Fibrillarin

Nop1p / Fibrillarin was originally identified as a nucleolar protein of bakers yeast, Saccharomyces cerevisiae (accession P15646). The Nop1p protein is essential for yeast viability and is localized in the nucleoli. The human homologue of Nop1p is fibrillarin (accession P22087) a component of the nucleolar small nuclear ribonucleoprotein (snRNP) particle. The human fibrillarin gene is located on chromosome 19 (19q13.1). Fibrillarin proteins have been cloned and sequenced from several other species (Mouse, accession P35550, Xenopus accession P22232, C. elegans accession Q22053, and S. pombe accession P35551). The N terminal 80 amino acids contain multiple copies based on the peptide RGG, and the remaining 240 amino acids consist of the fibrillarin domain. A fibrillarin homologue has also been identified in the genome of the archean Methanococcus (accession NC_000909). This protein lacks the RGG rich N-terminal extension but is clearly homologous to the other sequences throughout all of the fibrillarin domain. The structure of this molecule has been determined and shown to consist of 2 extended beta-sheets flanked by 4 alpha-helixes. Patients with the autoimmune disease scleroderma often have strong circulating autoantibodies to a 34kDa protein which was subsequently found to be fibrillarin. Fibrillarin is an excellent marker for the nucleolus.

Alternate Names

EC 2.1.1,34-kD nucleolar scleroderma antigen, EC 2.1.1.-, EC 2.1.1.37, FIB, FIB1,34 kDa nucleolar scleroderma antigen, fibrillarin, FLRNrRNA 2'-O-methyltransferase fibrillarin, RNA, U3 small nucleolar interacting protein 1, RNU3IP1

Gene Symbol

FBL

Additional Fibrillarin Products

Product Documents for Fibrillarin Antibody (9J5O2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Fibrillarin Antibody (9J5O2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.