FKBP25 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54354

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54354
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all FKBP25 Antibodies »

Product Summary for FKBP25 Antibody

Immunogen

Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FKBP25 Antibody

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Human Hela, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354]

Western Blot: FKBP25 Antibody [NBP1-54354] - Human 721_B, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in 721_B.
View 1 more images

Applications for FKBP25 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP25

FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Long Name

25 kDa FK506 Binding Protein

Alternate Names

FKBP3

Gene Symbol

FKBP3

UniProt

Q00688

Additional FKBP25 Products

Product Documents for FKBP25 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FKBP25 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.