G protein alpha inhibitor 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-52926

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-52926
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all G protein alpha inhibitor 1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GNAI1(guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1) The peptide sequence was selected from the middle region of GNAI1 (NP_002060). Peptide sequence YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha-1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for G protein alpha inhibitor 1 Antibody

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926]

Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
View 1 more images

Applications for G protein alpha inhibitor 1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G protein alpha inhibitor 1

Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Adenylate cyclase-inhibiting G alpha protein, Gi, Gi1 protein alpha subunit, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 1, guanine nucleotide-binding protein G(i) subunit alpha-1

Gene Symbol

GNAI1

UniProt

P63096 (Human)

Additional G protein alpha inhibitor 1 Products

Product Documents for G protein alpha inhibitor 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for G protein alpha inhibitor 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.