Gamma Adaptin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57633

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57633
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Gamma Adaptin Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Gamma Adaptin Antibody

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633]

Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml AP1G1 is supported by BioGPS gene expression data to be expressed in HepG2.
View 1 more images

Applications for Gamma Adaptin Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Gamma Adaptin

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, Gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255

Gene Symbol

AP1G1

UniProt

O43747 (Human)

Additional Gamma Adaptin Products

Product Documents for Gamma Adaptin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Gamma Adaptin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.