GAPDH Antibody (CL3266)
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59779
![Western Blot: GAPDH Antibody (CL3266) [NBP2-59779] Western Blot: GAPDH Antibody (CL3266) [NBP2-59779]](https://resources.bio-techne.com/images/products/GAPDH-Antibody-CL3266-Western-Blot-NBP2-59779-img0009.jpg)
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Predicted:
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2A Clone # CL3266
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This GAPDH antibody was developed against a recombinant protein corresponding to amino acids: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2A
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for GAPDH Antibody (CL3266)
Western Blot: GAPDH Antibody (CL3266) [NBP2-59779]
Western Blot: GAPDH Antibody (CL3266) [NBP2-59779] - GAPDH Antibody (2597) [NBP2-59779] - Theoretical molecular weight: 36 kDa. Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-GAPDH monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.Immunocytochemistry/ Immunofluorescence: GAPDH Antibody (CL3266) [NBP2-59779]
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (CL3266) [NBP2-59779] - Staining of A549 cells using the Anti-GAPDH monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).Western Blot: GAPDH Antibody (CL3266) [NBP2-59779]
Western Blot: GAPDH Antibody (CL3266) [NBP2-59779] - GAPDH Antibody (2597) [NBP2-59779] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431 and human cell line HepG2. Theoretical molecular weight: 36 kDa.Applications for GAPDH Antibody (CL3266)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
2-10 ug/ml
Immunohistochemistry
1:5000 - 1:10000
Immunohistochemistry-Paraffin
1:5000 - 1:10000
Western Blot
1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GAPDH
References
1) Barber RD, Harmer DW, Coleman RA, Clark BJ. (2005) GAPDH as a housekeeping gene: analysis of GAPDH mRNA expression in a panel of 72 human tissues. Physiol Genomics. 21(3):389-95. PMID: 15769908
2) Jia Y, Takimoto K. (2006) Mitogen-activated protein kinases control cardiac KChIP2 gene expression. Circ Res. 98(3):386-93. PMID: 16385079
3) Godsel LM, Hsieh SN, Amargo EV, Bass AE, Pascoe-McGillicuddy LT, Huen AC, Thorne ME, Gaudry CA, Park JK, Myung K, Goldman RD, Chew TL, Green KJ. (2005) Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin. J Cell Biol. 171(6):1045-59. PMID: 16365169
4) Sirover MA1. (1999) New insights into an old protein: the functional diversity of mammalian glyceraldehyde-3-phosphate dehydrogenase. Biochim Biophys Acta. 1432(2): 159-84. PMID: 10407139
5) Tristan C, Shahani N, Sedlak TW, Sawa A. (2011) The diverse functions of GAPDH: views from different subcellular compartments. Cell Signal. 23(2):317-23. PMID: 20727968
Long Name
Glyceraldehyde-3-phosphate Dehydrogenase
Alternate Names
G3PDH
Gene Symbol
GAPDH
Additional GAPDH Products
Product Documents for GAPDH Antibody (CL3266)
Product Specific Notices for GAPDH Antibody (CL3266)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...