GFR alpha-1/GDNF R alpha-1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14045

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14045
NBP2-14045-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GFR alpha-1/GDNF R alpha-1 Antibodies »

Product Summary for GFR alpha-1/GDNF R alpha-1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GFR alpha-1/GDNF R alpha-1 Antibody

Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunocytochemistry/ Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunocytochemistry/Immunofluorescence: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human kidney shows weak granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045]

Immunohistochemistry-Paraffin: GFR alpha-1/GDNF R alpha-1 Antibody [NBP2-14045] - Staining of human smooth muscle shows strong granular cytoplasmic positivity in smooth muscle cells.
View 3 more images

Applications for GFR alpha-1/GDNF R alpha-1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFR alpha-1/GDNF R alpha-1

Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRalpha, which is a cell surface receptor for GDNF (1,2). The cDNAs encoding GDNFRalpha from human, rat, chicken and mouse have been cloned recently (1-5). GDNFRalpha was also termed Ret ligand 1 (RETL1) or TGF-beta-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRalpha-1 recently (5-7). GFRalpha-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRalpha and the Ret PTK form a complex to transduce GDNF signal and to mediate GDNF function.

Long Name

Glial Cell line-derived Neurotrophic Factor Receptor alpha 1

Alternate Names

GDNF R alpha-1, GFR alpha1, GFRa-1, GFRA1

Gene Symbol

Gfra1

Additional GFR alpha-1/GDNF R alpha-1 Products

Product Documents for GFR alpha-1/GDNF R alpha-1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GFR alpha-1/GDNF R alpha-1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.