Glutathione Peroxidase 4/GPX4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54691

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54691
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Glutathione Peroxidase 4/GPX4 Antibodies »

Product Summary for Glutathione Peroxidase 4/GPX4 Antibody

Immunogen

Synthetic peptides corresponding to GPX4(glutathione peroxidase 4 (phospholipid hydroperoxidase)) The peptide sequence was selected from the middle region of GPX4. Peptide sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glutathione Peroxidase 4/GPX4 Antibody

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691] - 25 ug of indicated human cell extracts were loaded onto a 10% - 20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for NBP1-54691 is 1 - 3 ug/mL. Recognizes 19 kDa cytoplasmic form in these cell lines, mitochondrial form of 22 kDa appears absent in these samples.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691] - Human Heart Tissue, antibody concentration 5 ug/ml.

Applications for Glutathione Peroxidase 4/GPX4 Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
It is recommended to stain paraffin-embedded tissue samples with the antibody at 5ug/ml after heat-induced antigen retrieval with Sodium citrate buffer.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 4/GPX4

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Alternate Names

GPX4, PHGPx, snGPx

Gene Symbol

GPX4

UniProt

P36969 (Human)

Additional Glutathione Peroxidase 4/GPX4 Products

Product Documents for Glutathione Peroxidase 4/GPX4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Glutathione Peroxidase 4/GPX4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.