GNRHR2 Antibody (4A5)

Novus Biologicals, part of Bio-Techne | Catalog # H00114814-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00114814-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4A5

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GNRHR2 Antibodies »

Product Specifications

Immunogen

GNRHR2 (NP_001457, 237 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Specificity

GNRHR2 - gonadotropin-releasing hormone (type 2) receptor 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for GNRHR2 Antibody (4A5)

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5. Analysis of GNRHR2 expression in Raw 264.7.
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5 Analysis of GNRHR2 expression in HeLa.
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01]

Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5. Analysis of GNRHR2 expression in HepG2.
View 2 more images

Applications for GNRHR2 Antibody (4A5)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: GNRHR2

The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14.

Alternate Names

AC4, adenylate cyclase 4, adenylate cyclase type 4, Adenylate cyclase type IV, Adenylyl cyclase 4, ATP pyrophosphate-lyase 4, EC 4.6.1, EC 4.6.1.1

Entrez Gene IDs

114814 (Human)

Gene Symbol

GNRHR2

Additional GNRHR2 Products

Product Documents for GNRHR2 Antibody (4A5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GNRHR2 Antibody (4A5)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.