GPI8 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69262

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69262
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all GPI8 Antibodies »

Product Summary for GPI8 Antibody

Immunogen

Synthetic peptides corresponding to PIGK(phosphatidylinositol glycan anchor biosynthesis, class K) The peptide sequence was selected from the N terminal of PIGK. Peptide sequence SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GPI8 Antibody

Western Blot: GPI8 Antibody [NBP1-69262]

Western Blot: GPI8 Antibody [NBP1-69262]

Western Blot: GPI8 Antibody [NBP1-69262] - This Anti-PIGK antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Applications for GPI8 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPI8

PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

EC 3.-, GPI transamidase, GPI transamidase subunit, GPI8 homolog, GPI8class K, GPI-anchor transamidase, hGPI8, MGC22559, phosphatidylinositol glycan anchor biosynthesis, class K, Phosphatidylinositol-glycan biosynthesis class K protein, PIG-K

Gene Symbol

PIGK

UniProt

Q92643 (Human)

Additional GPI8 Products

Product Documents for GPI8 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GPI8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.