Granzyme K Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24886

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24886
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Granzyme K Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Granzyme K using the following amino acid sequence: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Granzyme K Antibody

Granzyme K Antibody Immunocytochemistry/Immunofluorescence: Granzyme K Antibody [NBP3-24886]

Immunocytochemistry/Immunofluorescence: Granzyme K Antibody [NBP3-24886]

Staining of human cell line JURKAT shows localization to the Golgi apparatus.

Applications for Granzyme K Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Granzyme K

The granzyme family of proteins belong to the larger peptidase S1 family. Granzyme A and granzyme B are serine proteases that facilitate apoptotic signaling in cytotoxic T lymphocytes (CTL) and natural killer (NK) cells. Within the granules of activated CTLs, granzyme A and B are processed and converted to their active forms by the lysosomal cysteine protease cathepsin C. Once cleaved, these active proteases target distinct substrates for proteolysis and, thereby, mediate apoptosis through two different pathways. Granzyme H localizes to cytoplasmic granules of cytolytic T lymphocytes and is important for target cell lysis in cell-mediated immune responses. Granzyme K (GMZK), also designated granzyme-3 or NK-tryptase-2 (NK-TRYP-2), contains one peptidase S1 domain. Granzyme K is a serine protease localizing to the granules of natural killer cells and cytotoxic T lymphocytes. It is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Alternate Names

Fragmentin-3, Granzyme 3, Granzyme-K, GZMK, NK-Tryp-2, NK-Tryptase-2, TRYP2, Tryptase II

Gene Symbol

GZMK

Additional Granzyme K Products

Product Documents for Granzyme K Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Granzyme K Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.