GSTA4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54817

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54817
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all GSTA4 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GSTA4(glutathione S-transferase A4) The peptide sequence was selected from the C terminal of GSTA4. Peptide sequence LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GSTA4 Antibody

Western Blot: GSTA4 Antibody [NBP1-54817]

Western Blot: GSTA4 Antibody [NBP1-54817]

Western Blot: GSTA4 Antibody [NBP1-54817] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: GSTA4 Antibody [NBP1-54817]

Immunohistochemistry: GSTA4 Antibody [NBP1-54817]

Immunohistochemistry: GSTA4 Antibody [NBP1-54817] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for GSTA4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTA4

GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DKFZp686D21185, EC 2.5.1.18, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4, Glutathione S-transferase A4-4, glutathione S-transferase alpha 4, glutathione transferase A4-4, GST class-alpha member 4, GSTA4-4, GTA4, S-(hydroxyalkyl)glutathione lyase A4

Gene Symbol

GSTA4

UniProt

O15217 (Human)

Additional GSTA4 Products

Product Documents for GSTA4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GSTA4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.