Skip to main content

GTF3A Antibody [Alexa Fluor® 700]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38541AF700

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human

Applications

ELISA, Western Blot

Label

Alexa Fluor 700 (Excitation = 675-700 nm, Emission = 723 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF3A (NP_002088.2).

Sequence:
MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPFVCDYEGCGKAFIRDYHLSRHILTHTGEKPF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for GTF3A Antibody [Alexa Fluor® 700]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: GTF3A

The GTF3A gene encodes a zinc finger protein with nine Cis(2)-His(2) domains that interacts with the internal control region (ICR) of approximately 50 bases within 5S RNA genes. This is where it works as a RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The proteins coded by the GTF3A gene also play a role in regulating the stability of transcription of other genes. The GTF3A gene exists in two isoforms: isoform 1 is 365 amino acids long at 41 kDA while isoform 2 is 340 amino acids long at 38 kDA. GTF3A has been investigated in its role in apnea, glaucoma, digeorge syndrome, acute liver failure, and endocarditis. GTF3A participates in RNA polymerase III transcription and interacts with genes ABL1, FYN, CXCR2, GTF3C2, and EPN1.

Alternate Names

general transcription factor IIIA, TFIIIAAP2, transcription factor IIIA

Gene Symbol

GTF3A

Additional GTF3A Products

Product Documents for GTF3A Antibody [Alexa Fluor® 700]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GTF3A Antibody [Alexa Fluor® 700]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...