GTPBP4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38104

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-38104-100ul
NBP3-38104-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all GTPBP4 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 385-634 of human GTPBP4 (NP_036473.2).

Sequence:
RKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GTPBP4 Antibody

GTPBP4 Antibody

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] -

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using GTPBP4 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GTPBP4 Antibody

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] -

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using GTPBP4 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
GTPBP4 Antibody

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] -

Immunohistochemistry: GTPBP4 Antibody [NBP3-38104] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using GTPBP4 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
View 2 more images

Applications for GTPBP4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GTPBP4

GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target. [provided by RefSeq]

Alternate Names

Chronic renal failure gene protein, CRFGGTP-binding protein NGB, FLJ10686, FLJ10690, G protein-binding protein CRFG, GTP binding protein 4, NGB, NOG1FLJ39774, nucleolar GTP-binding protein 1

Gene Symbol

GTPBP4

Additional GTPBP4 Products

Product Documents for GTPBP4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GTPBP4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.