H2AFV Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84057

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84057-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all H2AFV Antibodies »

Product Summary for H2AFV Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV. Peptide sequence: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for H2AFV Antibody

Western Blot: H2AFV Antibody [NBP2-84057]

Western Blot: H2AFV Antibody [NBP2-84057]

Western Blot: H2AFV Antibody [NBP2-84057] - Host: Rabbit. Target Name: H2AFV. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that H2AFV is expressed in HEK293T

Applications for H2AFV Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: H2AFV

H2AFV is 128 amino acids long, weighs approximately 13.5 kDa, and the gene codes for a variant component that is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. H2AFV has three shorter isoforms that are 114, 90, and 102 amino acids long, weighing 12, 9, and 11 kDa respectively. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, malaria, ataxia telangiectasia, intrahepatic cholangiocarcinoma, pharyngitis, and immunodeficiency. H2AFV has also been shown to have interactions with MORF4L1, MRGBP, PAX9, CAMSAP2, and ATG4C in pathways such as the systemic lupus erythematosus pathways.

Alternate Names

FLJ26479, H2A histone family, member V, H2A.F/Z, H2AV, histone H2A.F/Z, histone H2A.V, MGC10170, MGC10831, MGC1947, purine-rich binding element protein B

Gene Symbol

H2AZ2

Additional H2AFV Products

Product Documents for H2AFV Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for H2AFV Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.