HBG1/2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98291

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-98291
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all HBG1/2 Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is HBG2 - middle region. Peptide sequence MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

147 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HBG1/2 Antibody

Western Blot: HBG1/2 Antibody [NBP1-98291]

Western Blot: HBG1/2 Antibody [NBP1-98291]

Western Blot: HBG1/2 Antibody [NBP1-98291] - Western blot analysis of human fetal liver using NBP1-98291. Antibody Dilution: 1.0 ug/ml
Western Blot: HBG1/2 Antibody [NBP1-98291]

Western Blot: HBG1/2 Antibody [NBP1-98291]

Western Blot: HBG1/2 Antibody [NBP1-98291] - Hemoglobin gamma-2 chain Antibody [NBP1-98291] - Human Fetal Kidney Lysate 1.0ug/ml, Gel Concentration: 10-20%

Applications for HBG1/2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HBG1/2

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.

Alternate Names

abnormal hemoglobin, A-gamma globin, gamma A hemoglobin, gamma globin, Gamma-1-globin, gamma-2-globin, gamma-globin chain, G-gamma globin Paulinia, Hb F Agamma, hb F Ggamma, HBGA, HBGR, HBG-T1, HBG-T2, Hemoglobin gamma-1 chain, hemoglobin gamma-2 chain, Hemoglobin gamma-A chain, hemoglobin gamma-G chain, hemoglobin subunit gamma-1, hemoglobin subunit gamma-2, hemoglobin, gamma A, hemoglobin, gamma G, hemoglobin, gamma, regulator of, HSGGL1, methemoglobin, PRO2979, TNCY

Gene Symbol

HBG1

UniProt

NP_000175 (Human)

Additional HBG1/2 Products

Product Documents for HBG1/2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HBG1/2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.