HIST1H3D Antibody (1D8)

Novus Biologicals, part of Bio-Techne | Catalog # H00008351-M01

Submit a review

Product Datasheet / COA / SDS

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG3 Kappa Clone # 1D8

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all HIST1H3D Antibodies »

Product Specifications

Immunogen

HIST1H3D (NP_003521, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

HIST1H3D (1D8)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG3 Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HIST1H3D Antibody (1D8)

Western Blot: HIST1H3D Antibody (1D8) [H00008351-M01]

Western Blot: HIST1H3D Antibody (1D8) [H00008351-M01] - HIST1H3D monoclonal antibody (M01), clone 1D8. Analysis of HIST1H3D expression in Raw 264.7.

Immunocytochemistry/ Immunofluorescence: HIST1H3D Antibody (1D8) [H00008351-M01]

Immunocytochemistry/Immunofluorescence: HIST1H3D Antibody (1D8) [H00008351-M01] - Analysis of monoclonal antibody to HIST1H3D on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: HIST1H3D Antibody (1D8) [H00008351-M01]

Immunohistochemistry-Paraffin: HIST1H3D Antibody (1D8) [H00008351-M01] - Analysis of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. Antibody concentration 3 ug/ml.

View 2 more images

Applications for HIST1H3D Antibody (1D8)

Application

Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Application Notes

Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HIST1H3D

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Alternate Names

H3 histone family, member L, H3/l, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FLHIST1H3E, HIST1H3A, HIST1H3C, HIST1H3D, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, histone 1, H3b, histone cluster 1, H3b, histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l

Entrez Gene IDs

8351 (Human)

Gene Symbol

HIST1H3D

OMIM

602811 (Human)

UniProt

NP_003521 (Human)

Additional HIST1H3D Products

Product Documents for HIST1H3D Antibody (1D8)

Product Datasheets

Download Product Datasheets

COA

SDS

Product Specific Notices for HIST1H3D Antibody (1D8)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations
Reviews