Histone H2AY/macroH2A.1 Antibody (4D2O4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16743

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16743-100ul
NBP3-16743-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4D2O4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Histone H2AY Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Histone H2AY/macroH2A.1 (O75367). IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Western blot analysis of extracts of various cell lines, using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunofluorescence analysis of U-2 OS cells using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunohistochemistry-Paraffin: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunohistochemistry-Paraffin: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry of paraffin-embedded mouse lung using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H2AY

macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.

Long Name

H2A Histone Family, Member Y

Alternate Names

H2AF12M, H2AFJ, H2AFY, Histone MacroH2A1, Medulloblastoma Antigen MU-MB-50.205

Gene Symbol

MACROH2A1

Additional Histone H2AY Products

Product Documents for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Histone H2AY/macroH2A.1 Antibody (4D2O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.