Histone H2B type 2E Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03254
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Histone H2B type 2E (NP_003519.1). MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Histone H2B type 2E Antibody - Azide and BSA Free
Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] -
Western Blot: Histone H2B type 2E Antibody - Azide and BSA Free [Histone H2B type 2E] - Western blot analysis of various lysates, using Histone H2B type 2E Rabbit pAb at 1:10000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 90s.
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Mouse liver using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody - Azide and BSA Free [NBP3-03254]
Immunohistochemistry-Paraffin: Histone H2B type 2E Antibody [NBP3-03254] - Human esophagus using Histone H2B type 2E antibody at dilution of 1:100 (40x lens).Applications for Histone H2B type 2E Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:2000 - 1:10000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Histone H2B type 2E
Alternate Names
GL105, H2B, H2B Histone Family, Member Q, H2B.1, Histone 2, H2be, Histone Cluster 2 H2B Family Member E, Histone Cluster 2, H2be, Histone H2B Type 2-E, Histone H2B.Q, Histone H2B-GL105
Gene Symbol
H2BC21
Additional Histone H2B type 2E Products
Product Documents for Histone H2B type 2E Antibody - Azide and BSA Free
Product Specific Notices for Histone H2B type 2E Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov