Skip to main content

HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 532]

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-41336AF532

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Virus

Applications

ELISA, Western Blot

Label

Alexa Fluor 532

Antibody Source

Monoclonal Mouse IgG1 Clone # 8G9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla

Reactivity Notes

0

Specificity

By Western blot, anti-HIV-1 Gag p24 antibody detects a ~24 kDa, a ~41 kDa, and a ~55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 532]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: HIV-1 Gag p24

The gag gene of human immunodeficiency virus 1 (HIV-1) encodes a precursor protein known as Pr55Gag. The viral protease PR cleaves this precursor to generate p17, p24, p7, and p6 proteins which are required for virus particle assembly. p24 is a major viral core structural protein. Its measurement is commonly used as an indicator of HIV-1 infection and viral load.

Long Name

Human Immunodeficiency Virus Type 1 GAG/Group-specific Antigen core protein of 24 kDa

Alternate Names

CA, Capsid Protein, HIV1 Gag p24, Pr55(Gag)

Gene Symbol

gag

Additional HIV-1 Gag p24 Products

Product Documents for HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 532]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HIV-1 Gag p24 Antibody (8G9) [Alexa Fluor® 532]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...