HLA DRB3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82248

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82248-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all HLA DRB3 Antibodies »

Product Summary for HLA DRB3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of HLA DRB3. Peptide sequence: GFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HLA DRB3 Antibody

Western Blot: HLA DRB3 Antibody [NBP2-82248]

Western Blot: HLA DRB3 Antibody [NBP2-82248]

Western Blot: HLA DRB3 Antibody [NBP2-82248] - WB Suggested Anti-HLA-DRB3 Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell

Applications for HLA DRB3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DRB3

HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq]

Alternate Names

DR7, HLA class II histocompatibility antigen, DR beta 3 chain, HLA class II histocompatibility antigen, DRB1-7 beta chain, HLA-DR3B, HLA-DR52, HLA-DRB1, human leucocyte antigen DRB3, major histocompatibility complex, class II, DR beta 3, MGC117330, MHC class II antigen DR beta 3 chain, MHC class II antigen DRB3, MHC class II HLA-DR beta 3 chain

Gene Symbol

HLA-DRB3

Additional HLA DRB3 Products

Product Documents for HLA DRB3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HLA DRB3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.